PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P19350_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MIKC_MADS
Protein Properties Length: 224aa    MW: 25851.8 Da    PI: 6.7252
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P19350_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.42.5e-251058250
                            ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                  SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                            rien   rqvtf+kRr+g+lKKA ELSvLCda++ +iifs +gklye +
  GSMUA_Achr11P19350_001 10 RIENPVHRQVTFCKRRAGLLKKARELSVLCDADIGIIIFSAHGKLYELA 58
                            8*********************************************965 PP

2K-box54.64.7e-19851731299
                   K-box  12 akaeslqqelakLkkeienLqreqRhllGedLe.sLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                             +  +++++e++ Lk+ei+ L +++R + Ge+ +  ++l+e+  Le++Le  +++iR+ K+++++++i+ l++ke +l+ +n+ L++k
  GSMUA_Achr11P19350_001  85 NPPQESEREISMLKQEINLLHKSLRYMFGEGTSgHMTLEEMYALERHLEIWMEHIRTMKMQIMFQEIQSLKNKEGMLRATNEFLQEK 171
                             5568999***********************98537**************************************************** PP

                   K-box  98 le 99 
                             + 
  GSMUA_Achr11P19350_001 172 IV 173
                             96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.5E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.324161IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.76E-27176IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002659.60E-40375No hitNo description
PfamPF003191.0E-231056IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.01887178IPR002487Transcription factor, K-box
PfamPF014862.1E-2288172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MVRGKVQLRR IENPVHRQVT FCKRRAGLLK KARELSVLCD ADIGIIIFSA HGKLYELATK  60
GTMEGLIERY KMTSEEPQPA SADVNPPQES EREISMLKQE INLLHKSLRY MFGEGTSGHM  120
TLEEMYALER HLEIWMEHIR TMKMQIMFQE IQSLKNKEGM LRATNEFLQE KIVEQNGHFD  180
VAPMTVQQNG HFDVAPLTAT DIPYPLTIQS QLNNFWGPEQ GFSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A3e-15386281Myocyte-specific enhancer factor 2A
3kov_B3e-15386281Myocyte-specific enhancer factor 2A
3kov_I3e-15386281Myocyte-specific enhancer factor 2A
3kov_J3e-15386281Myocyte-specific enhancer factor 2A
3p57_A3e-15386281Myocyte-specific enhancer factor 2A
3p57_B3e-15386281Myocyte-specific enhancer factor 2A
3p57_C3e-15386281Myocyte-specific enhancer factor 2A
3p57_D3e-15386281Myocyte-specific enhancer factor 2A
3p57_I3e-15386281Myocyte-specific enhancer factor 2A
3p57_J3e-15386281Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009384283.11e-169PREDICTED: MADS-box transcription factor 26-like
SwissprotA2YQK91e-101MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G81e-101MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLM0RTL51e-169M0RTL5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P19350_0011e-168(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.11e-68AGAMOUS-like 12